Comments (4)
@BiochemStudent2
You can try something along these lines:
from proteinbert import load_pretrained_model
seq = 'MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL'
seq_len = 512
pretrained_model_generator, input_encoder = load_pretrained_model()
X = input_encoder.encode_X([seq], seq_len)
model = pretrained_model_generator.create_model(seq_len)
y_seq, y_annotations = model.predict(X, batch_size = 1)
from protein_bert.
Thank you so much! This works great.
from protein_bert.
seq_len
Hi there.
For the seq_len specified in this code, do we have to set the seq_len here, to be the same value as 'seq_len' OR the 'final_seq_len' we used during fine tuning, if we are now trying to use the fine tuned model, to now do predictions based on the fine tuning? As we have the seq_len and final_seq_len as different values. Kindly advise.
from protein_bert.
@ZakiaSalod The model is designed such that it should be quite flexible about seq_len and work reasonably well with different values even without further training of the model (that's in fact one of the motivation of pre-training it with different sequence lengths and fine-tuning it with seq_len and final_seq_len that are different). Having said that, I expect that a seq_len equal to the original seq_len (not final_seq_len) used during fine-tuning may provide slightly better performance. However, if a larger seq_len is called for (e.g. if you need to process longer sequences) don't hesitate to use larger values.
from protein_bert.
Related Issues (20)
- Error when trying to run benchmarks HOT 1
- Failing to get the weights from the dedicated github repo HOT 5
- Use ProteinBERT with Own Dataset HOT 3
- Original h5 file HOT 5
- loss plot during pretraining HOT 1
- signal peptide detection HOT 1
- KeyError: "Unable to open object (object 'test_set_mask' doesn't exist)" HOT 6
- How to extract the embedding of an amino acid? HOT 10
- Graph execution error HOT 6
- Extract local and global representation using finetune model HOT 1
- Running Benchmarks HOT 4
- Evaluation on larger data set HOT 3
- Using vector representations in the "weights" parameter in the "embedding" section of an LSTM model after fine-tuning my own data HOT 1
- Failing to extract global embedding (1,15599) -> (1,512) HOT 1
- What do the settings mean? HOT 3
- Error when trying to run the finetuning code given in the jupyter notebook HOT 2
- ValueError, set_weights error
- model_generation.py list is not callable error HOT 2
- GO annotations during fine tuning HOT 1
- Missing MajorPTMs train CSV file HOT 1
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from protein_bert.