Giter VIP home page Giter VIP logo

pymolfold's Introduction

PymolFold

Fold your protein in PyMOL!
Inspired by ColabFold by Sergey O.
Visualization inspired by pymol-color-alphafold.
Thanks to ESMFold by Meta and the API.

Tested under macOS Monterey Version 12.5.1, Python 3.7.12.
Open an issue if ran into any errors.

03Dec2022: Add `dms`, `singlemut`, and `webapps`. `pymolfold` allow sequence length up to 700aa.
26Nov2022: ProteinMPNN is now integrated to design proteins.
15Nov2022: We now provide an unofficial API to support user defined recycle number and allow sequence length up to 500aa!

Install pymol-open-source

conda install -c conda-forge pymol-open-source

Usage

1. Load extension into PyMOL. In the PyMOL command prompt

run https://raw.githubusercontent.com/JinyuanSun/PymolFold/main/predict_structure.py
# for user still using python2, it is also py3 compatible, only esmfold supports.
run https://raw.githubusercontent.com/JinyuanSun/PymolFold/py27/predict_structure.py
# try the command below in China mainland, the mirror will be delayed if modifications were just made, download the file to your computer and install it is always a good idea:
run https://raw.staticdn.net/JinyuanSun/PymolFold/main/predict_structure.py

2. Fold your protein

webapp avaiable at here, in case someone struggles with using PyMOL.
Also, check META's web app

The color_plddt command also returns pymol selection object of different confidence levels. The color scheme is now compatible with plddt in range (0, 1) and (0, 100) only if they are consistent in your selection.

The Meta API (up to 400 aa)

esmfold GENGEIPLEIRATTGAEVDTRAVTAVEMTEGTLGIFRLPEEDYTALENFRYNRVAGENWKPASTVIYVGGTYARLCAYAPYNSVEFKNSSLKTEAGLTMQTYAAEKDMRFAVSGGDEVWKKTPTANFELKRAYARLVLSVVRDATYPNTCKITKAKIEAFTGNIITANTVDISTGTEGSGTQTPQYIHTVTTGLKDGFAIGLPQQTFSGGVVLTLTVDGMEYSVTIPANKLSTFVRGTKYIVSLAVKGGKLTLMSDKILIDKDWAEVQTGTGGSGDDYDTSFN, test
color_plddt
orient 
ray 1280, 960, async=1

The PymolFold API (up to 500 aa, number of recycle can be set in range (3,24))

pymolfold GENGEIPLEIRATTGAEVDTRAVTAVEMTEGTLGIFRLPEEDYTALENFRYNRVAGENWKPASTVIYVGGTYARLCAYAPYNSVEFKNSSLKTEAGLTMQTYAAEKDMRFAVSGGDEVWKKTPTANFELKRAYARLVLSVVRDATYPNTCKITKAKIEAFTGNIITANTVDISTGTEGSGTQTPQYIHTVTTGLKDGFAIGLPQQTFSGGVVLTLTVDGMEYSVTIPANKLSTFVRGTKYIVSLAVKGGKLTLMSDKILIDKDWAEVQTGTGGSGDDYDTSFN, 4, test
color_plddt
orient 
ray 1280, 960, async=1

3. Design Your Protein

Thanks to ColabDeisgn by Sergey O.

cpd for sequence generation Webapp

Use cpd to design seqeunces will fold into the target structure:

# commands
fetch 1pga.A
cpd 1pga.A
# output looks like:
# >des_0,score=0.72317,seqid=0.6607
# PTYKLIINGKKIKGEISVEAPDAKTAEKIFKNYAKENGVNGKWTYDESTKTFTIEE
# >des_1,score=0.73929,seqid=0.6250
# PTYTLVVNGKKIKGTRSVEAPNAAVAEKIFKQWAKENGVNGTWTYDASTKTFTVTE
# >des_2,score=0.72401,seqid=0.6429
# PTYTLKINGKKIKGEISVEAPNAEEAEKIFKQYAKDHGVNGKWTYDASTKTFTVTE

Using esmfold to examin the des_0:

# commands
esmfold PTYKLIINGKKIKGEISVEAPDAKTAEKIFKNYAKENGVNGKWTYDESTKTFTIEE, 1pga_des0
super 1pga_des0, 1pga.A
color_plddt 1pga_des0

singlemut for scoring a signle mutation Webapp

# commands
fetch 1pga.A
singlemut 1pga.A, A, 26, F
# output maybe (not deterministic):
# ================================
# mutation: A_26_F, score: -0.0877
# ================================

dms for in silico deep mutational scan Webapp

# commands
fetch 1pga.A
select resi 1-10
dms sele
# this might took ~1 min, be pacient ; )
# output:
# Results save to '/pat/to/working/dir/dms_results.csv'

Reference

@article{lin2022language,
  title={Language models of protein sequences at the scale of evolution enable accurate structure prediction},
  author={Lin, Zeming and Akin, Halil and Rao, Roshan and Hie, Brian and Zhu, Zhongkai and Lu, Wenting and dos Santos Costa, Allan and Fazel-Zarandi, Maryam and Sercu, Tom and Candido, Sal and others},
  journal={bioRxiv},
  year={2022},
  publisher={Cold Spring Harbor Laboratory}
}
@article{
doi:10.1126/science.add2187,
author = {J. Dauparas  and I. Anishchenko  and N. Bennett  and H. Bai  and R. J. Ragotte  and L. F. Milles  and B. I. M. Wicky  and A. Courbet  and R. J. de Haas  and N. Bethel  and P. J. Y. Leung  and T. F. Huddy  and S. Pellock  and D. Tischer  and F. Chan  and B. Koepnick  and H. Nguyen  and A. Kang  and B. Sankaran  and A. K. Bera  and N. P. King  and D. Baker },
title = {Robust deep learning-based protein sequence design using ProteinMPNN},
journal = {Science},
volume = {378},
number = {6615},
pages = {49-56},
year = {2022},
doi = {10.1126/science.add2187},
URL = {https://www.science.org/doi/abs/10.1126/science.add2187}
}

PyMOL is a trademark of Schrodinger, LLC.

pymolfold's People

Contributors

jinyuansun avatar yaoyinying avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.