Giter VIP home page Giter VIP logo

iepapi's Introduction

IEPAPI: A method for immune epitope prediction by incorporating antigen presentation and immunogenicity


1. System requirements

1) Dependencies and operating systems

python(version=3.7.9); torch(version=1.8.0);torchvision(version==0.2.2); numpy(version==1.18.5); pandas(version=1.2.4); tqdm(version=4.19.9); matplotlib(version=3.3.2); seaborn(version=0.11.1);weblogo(version=3.7.12)

It is recommended to use the linux system, here we used Centos Linux release 7.9.2009(Core) system.

2) Required non-standard hardware

We employed Tesla K80 and Intel(R) Xeon(R) CPU E5-2678 v3 @2.50GHz.

3) Version information

This is the 1th version which has been tested on independent antigen presentation and immunogenicity test datasets.

2. Installation guide

Download the source code and unzip it. Simply enter the directory of IEPAPI and install all required dependencies on your operating system:

cd ./IEPAPI-main
pip install -r dependencies.txt

3. Demo

3.1 Prediction Demo

  • Organize your input information in the following format:

    Alternative text
  • Run the command to make a prediction:

    python IEPAPI_predict.py --input test.csv --output output_demo.csv
  • --input: the first column is the sequence of the peptide, the second column is the name of the HLA, and the third column is the pseudo-sequence of the HLA. The file ". /data/pseudoSequence(ELIM).csv" records the pseudo sequences of all HLA isoforms used in this study. For other HLA isoforms, their pseudo sequences can be found in the file ". /data/NetMHCpan4.1/MHC_pseudo.dat".

  • --output: the path where you want to save the prediction results. Here, the expected output will be saved in the file "./output_demo.csv".

    Alternative text

3.2 Immune Epitope Motif Demo

  • Run the command to obtain the immune epitope motif for the specified HLA:

    python IEPAPI_motif.py --MHC HLA-A*11:01 --MHCseq YYAMYQENVAQTDVDTLYIIYRDYTWAAQAYRWY --require_pdf True
  • --MHC: the name of the MHC molecule

  • --MHCseq: the pseudo-sequence of the MHC molecule

  • --require_pdf: If set to False, only images in JPEG format are output. If set to True, images in PDF format will also be output.

  • For HLA-A*11:01, both motifs for antigen presentation and immunogenicity will be generated in the format of heatmaps and sequence logos, which can reflect the immune epitope pattern.

    Alternative textAlternative text

Alternative textAlternative text

4. Reproduction guidance

a) Download all data from the Mendeley Data website (https://data.mendeley.com/datasets/fwxg5mgntn) and place the data in the ". /data/processed" directory

b)Training the IEPAPI-EL model

 python  main_train_Model_EL.py   --fold 0   --index 0
 python  main_train_Model_EL.py   --fold 1   --index 0
 python  main_train_Model_EL.py   --fold 2   --index 0
 python  main_train_Model_EL.py   --fold 3   --index 0
 python  main_train_Model_EL.py   --fold 4   --index 0

c)Training the IEPAPI-IM model

 python  main_train_Model_IM.py   --fold 0   --index 0
 python  main_train_Model_IM.py   --fold 1   --index 0
 python  main_train_Model_IM.py   --fold 2   --index 0
 python  main_train_Model_IM.py   --fold 3   --index 0
 python  main_train_Model_IM.py   --fold 4   --index 0

d)Make predictions for the test datasets

 python IEPAPI_predict.py --input ./data/processed/DataS3.csv --output ./output/results/DataS3_by_IEPAPI.csv
 python IEPAPI_predict.py --input ./data/processed/DataS4.csv --output ./output/results/DataS4_by_IEPAPI.csv
 python IEPAPI_predict.py --input ./data/processed/DataS5.csv --output ./output/results/DataS5_by_IEPAPI.csv

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. 📊📈🎉

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google ❤️ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.