Giter VIP home page Giter VIP logo

phylogenetic-likelihood's Introduction

phylogenetic-likelihood

JavaScript implementation of phylogenetic likelihood calculations & ancestral sequence reconstruction.

const pl = require ('phylogenetic-likelihood')

const nodeProfiles = pl.getNodePostProfiles
({ 'nodeSeq': { 'Q9DR80_9BETC': 'IGDLKCTT.VSINDVDTGVPSISTDTVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGST',
                'E5RPZ2_9BETC': 'VGDVKCTT.IGVNDFNSGAPVISTETVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGAN',
                'SPIKE_CVHN2':  'IGDFNCTN.SFINDYNKTIPRISEDVVDVSLGLGTYYVLNRVYLNTTLLFTGYFPKSGAN',
                'Q98341_9BETC': 'IGDFRCINLVNTDTSNASAPSVSTEVVDVSKGIGTYYVLDRVYLNATLLLTGYYPVDGSN',
                'Q98339_9BETC': 'IGDFRCIQLVNSNGANVSAPSISTETVDVSQGLGTYYVLDRVYLNATLLLTGYYPVDGSK' },
   'branchList': [['root', 'Q9DR80_9BETC', 0.15084],
                  ['root', 'node1', 0],
                  ['node1', 'E5RPZ2_9BETC', 0.19369],
                  ['node1', 'node2', 0.15833],
                  ['node2', 'SPIKE_CVHN2', 0.26651],
                  ['node2', 'node3', 0.41031],
                  ['node3', 'Q98341_9BETC', 0.07174],
                  ['node3', 'Q98339_9BETC', 0.18547]] })

console.log (JSON.stringify (nodeProfiles, null, 2))

phylogenetic-likelihood's People

Contributors

ihh avatar

Stargazers

Wytamma Wirth avatar

Watchers

 avatar James Cloos avatar  avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.