Giter VIP home page Giter VIP logo

gget's Introduction

gget

pypi version image Downloads license status Code Coverage

gget is a free, open-source command-line tool and Python package that enables efficient querying of genomic databases. gget consists of a collection of separate but interoperable modules, each designed to facilitate one type of database querying in a single line of code.

alt text

If you use gget in a publication, please cite*:

Luebbert, L. & Pachter, L. (2022). Efficient querying of genomic reference databases with gget. bioRxiv 2022.05.17.492392

Read the manuscript here: https://doi.org/10.1101/2022.05.17.492392

Installation

pip install --upgrade gget

Alternative:

conda install -c bioconda gget

For use in Jupyter Lab / Google Colab:

import gget

๐Ÿช„ Quick start guide

Command line:

# Fetch all Homo sapiens reference and annotation FTPs from the latest Ensembl release
$ gget ref homo_sapiens

# Get Ensembl IDs of human genes with "ace2" or "angiotensin converting enzyme 2" in their name/description
$ gget search -s homo_sapiens 'ace2' 'angiotensin converting enzyme 2'

# Look up gene ENSG00000130234 (ACE2) and its transcript ENST00000252519
$ gget info ENSG00000130234 ENST00000252519

# Fetch the amino acid sequence of the canonical transcript of gene ENSG00000130234
$ gget seq --translate ENSG00000130234

# Quickly find the genomic location of (the start of) that amino acid sequence
$ gget blat MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# BLAST (the start of) that amino acid sequence
$ gget blast MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Align nucleotide or amino acid sequences stored in a FASTA file
$ gget muscle path/to/file.fa

# Use Enrichr for an ontology analysis of a list of genes
$ gget enrichr -db ontology ACE2 AGT AGTR1 ACE AGTRAP AGTR2 ACE3P

# Get the human tissue expression of gene ACE2
$ gget archs4 -w tissue ACE2

# Get the protein structure (in PDB format) of ACE2 as stored in the Protein Data Bank (PDB ID returned by gget info)
$ gget pdb 1R42 -o 1R42.pdb

# Predict the protein structure of GFP from its amino acid sequence
$ gget setup alphafold # setup only needs to be run once
$ gget alphafold MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Python (Jupyter Lab / Google Colab):

import gget
gget.ref("homo_sapiens")
gget.search(["ace2", "angiotensin converting enzyme 2"], "homo_sapiens")
gget.info(["ENSG00000130234", "ENST00000252519"])
gget.seq("ENSG00000130234", translate=True)
gget.blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.muscle("path/to/file.fa")
gget.enrichr(["ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"], database="ontology", plot=True)
gget.archs4("ACE2", which="tissue")
gget.pdb("1R42", save=True)

gget.setup("alphafold") # setup only needs to be run once
gget.alphafold("MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK")

Call gget from R using reticulate:

system("pip install gget")
install.packages("reticulate")
library(reticulate)
gget <- import("gget")

gget$ref("homo_sapiens")
gget$search(list("ace2", "angiotensin converting enzyme 2"), "homo_sapiens")
gget$info(list("ENSG00000130234", "ENST00000252519"))
gget$seq("ENSG00000130234", translate=TRUE)
gget$blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$muscle("path/to/file.fa", out="path/to/out.afa")
gget$enrichr(list("ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"), database="ontology")
gget$archs4("ACE2", which="tissue")
gget$pdb("1R42", save=TRUE)

gget's People

Contributors

lakigigar avatar lauraluebbert avatar nh13 avatar

Watchers

 avatar  avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.