Comments (7)
Hello,
(1) Do you want to do the cs219 files for version 3 with version 3?
What was your command? Can you paste the corresponding entry of 4jdv_L.a3m?
(2) HHblits always needed the cs219 sequences for the prefilter. HHsearch needs the cs219 sequences now too, since we have rewritten the Viterbi algorithm, it was useful to sort the hhm's by the number of their match states. That is equal to the length of their cs219 sequences (equals the length of their entries in the cs219 ffindex). Otherwise we would have to preprocess the hhm's or a3m's in hhsearch.
from hh-suite.
yes i like to build cs219 files for v3 using v3 tools. are cs219 files from v2 and v3 cross-compatible?
i first used ffindex_build (v3) and existing a3m files (built by v2 tools) to make the corresponding _a3m.ff{data,index}, which i then used to make the v3 cs219 files using cstranslate (v3):
${HHLIB}/bin/cstranslate -A ${HHLIB}/data/cs219.lib -D ${HHLIB}/data/context_data.lib
-x 0.3 -c 4 -f -i _a3m -o _cs219 -I a3m -b
$ more 4jdv_L.a3m
4jdv_L
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTFTLTISSLEPEDFAVYYCQQYEFFGQGTKLEIK
ss_pred
CCCEECCCCCCCCCCCCCEEEEEECCCCCCCCEEEEEECCCCCCEEEEEECCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCEEEEEC
ss_conf
941650499201299995789997377932230321008999981268701556888889811153384168826899897556655314514892678859
from hh-suite.
Oh, I see. cstranslate cannot handle secondary structure annotations.
I will look into this. Just for the calculation of the cs219 sequences you could
generate an a3m ffdatabase without these secondary structure annotations.
On a sidenote: As far as I see, you seem to have a3m's with just a single sequence. HHblits and HHsearch perform much better with multiple sequence alignments in the database. Those can be generated with hhblits. It is explained in the userguide.
from hh-suite.
great markus. the moment i pasted the a3m file into the textbox, i also realized those a3m's i used were all just single sequences. yes MSA's will be much better for hhsuite.
okay i will remove the SS annotations and try again.
cheers,
fred
from hh-suite.
In the recent commit, cstranslate should now work with a3m's that include secondary structure annotations.
from hh-suite.
yes the new commit did allow me to use existing a3m files with secondary structure annotations. thank you very much.
from hh-suite.
This issue can be closed, right?
from hh-suite.
Related Issues (20)
- Does the template searching result contain query sequence's structure or not? HOT 3
- HHsearch - inconsistent results HOT 1
- HHblits failed
- hhmake issue
- hhmake issue
- c++: fatal error: Killed signal terminated program cc1plus HOT 1
- error while loading shared libraries: libHH_OBJECTS.so HOT 2
- Request to update the PDB70 database HOT 3
- Both HHBlits and HHSearch give misaligned indels for homologous sequences
- PackagesNotFoundError HOT 3
- HHblits Prefiltering database run time on Supercomputer Cluster HOT 3
- Segmentation fault with ffindex_apply -- hhmake
- Python 3.11 Support HOT 1
- 您好 制作属于自己的蛋白质数据集时出了问题
- Using hh-suites to find E.coli gene in other Proteobacteria <advice on the way I am using the method>
- Pfam36 Update HOT 1
- Segmentation Fault Running HHsearch
- HHblits failed : Unrecognized HMM file format in '468479486'
- PDB70 errors
- addss.pl calls blastpgp and makemat which are legacy blast commands HOT 3
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from hh-suite.